PDB entry 1sxx

View 1sxx on RCSB PDB site
Description: 1.0 A Crystal Structure of D129A/L130A Mutant of Nitrophorin 4 Complexed with Nitric Oxide
Class: Transport Protein
Keywords: lipocalin, beta barrel, ferric heme, nitric oxide, Transport Protein
Deposited on 2004-03-31, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: 0.141
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
    • engineered (128-129)
  Domains in SCOPe 2.08: d1sxxa_
• Heterogens: PO4, HEM, NO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxxA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkaagdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk