PDB entry 1sxw

View 1sxw on RCSB PDB site
Description: 1.05 a crystal structure of d30a mutant of nitrophorin 4 from rhodnius prolixus complexed with nitric oxide
Deposited on 2004-03-31, released 2004-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.154
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sxwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sxwA (A:)
actknaiaqtgfnkdkyfngdvwyvtdylalepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk