PDB entry 1sxv

View 1sxv on RCSB PDB site
Description: 1.3A Crystal structure of rv3628, Mycobacterium tuberculosis inorganic pyrophosphatase (PPase) at pH5.0
Class: hydrolase
Keywords: Mycobacterium tuberculosis, structural genomics, inorganic pyrophosphatase, PPase,, HYDROLASE
Deposited on 2004-03-31, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.155
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PPA, RV3628, MT3730, MTCY15C10.24, MB3652
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65746 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.07: d1sxva1, d1sxva2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxvA (A:)
    mgsshhhhhhmqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlg
    ddgdpldalvllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigd
    vpafeldaikhffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxvA (A:)
    hmqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldal
    vllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldai
    khffvhykdlepgkfvkaadwvdraeaeaevqrsverfka