PDB entry 1sxu

View 1sxu on RCSB PDB site
Description: 1.4 A Crystal Structure of D30N Mutant of Nitrophorin 4 from Rhodnius Prolixus Complexed with Imidazole
Class: transport protein
Keywords: lipocalin, beta barrel, ferric heme, imidazole, transport protein
Deposited on 2004-03-31, released 2004-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.143
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94734 (0-183)
      • engineered (29)
    Domains in SCOPe 2.05: d1sxua_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxuA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdylnlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk