PDB entry 1sxs

View 1sxs on RCSB PDB site
Description: Reduced bovine superoxide dismutase at pH 5.0 complexed with thiocyanate
Class: oxidoreductase
Keywords: oxidoreductase, superoxide acceptor
Deposited on 1998-09-24, released 1998-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cu-zn superoxide dismutase)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sxsa_
  • Chain 'B':
    Compound: protein (cu-zn superoxide dismutase)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sxsb_
  • Heterogens: SCN, CU, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sxsA (A:)
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sxsB (B:)
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak