PDB entry 1sxr

View 1sxr on RCSB PDB site
Description: Drosophila Peptidoglycan Recognition Protein (PGRP)-SA
Class: immune system
Keywords: Pattern Recognition Receptor, peptidoglycan, innate immunity, Toll pathway, IMMUNE SYSTEM
Deposited on 2004-03-31, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.181
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein SA CG11709-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VYX7 (Start-176)
      • expression tag (177-182)
    Domains in SCOPe 2.07: d1sxra1, d1sxra2
  • Chain 'B':
    Compound: Peptidoglycan recognition protein SA CG11709-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VYX7 (Start-176)
      • expression tag (177-182)
    Domains in SCOPe 2.07: d1sxrb1, d1sxrb2
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxrA (A:)
    gksrqrspancptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqn
    mqayhqneldfndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklp
    sdaalqaakdllacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxrA (A:)
    cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
    fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
    llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sxrB (B:)
    gksrqrspancptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqn
    mqayhqneldfndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklp
    sdaalqaakdllacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxrB (B:)
    cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
    fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
    llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphhhhhh