PDB entry 1sxp

View 1sxp on RCSB PDB site
Description: BGT in complex with a 13mer DNA containing a central A:G mismatch
Class: transferase/DNA
Keywords: flipped-out base, TRANSFERASE-DNA COMPLEX
Deposited on 2004-03-31, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: BGT, BETA-GT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sxpa_
  • Chain 'B':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: BGT, BETA-GT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sxpb_
  • Chain 'C':
    Compound: 5'-d(*a*ap*tp*ap*cp*tp*ap*ap*gp*ap*tp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*ap*tp*cp*tp*gp*ap*gp*tp*ap*tp*t)-3'
  • Heterogens: PG4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxpA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxpB (B:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.