PDB entry 1sxk

View 1sxk on RCSB PDB site
Description: Crystal Structure of a complex formed between phospholipase A2 and a non-specific anti-inflammatory amino salicylic acid at 1.2 A resolution
Class: toxin
Keywords: complex, phospholipase A2, amino salicylic acid, daboia russeli pulchella, TOXIN
Deposited on 2004-03-31, released 2004-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.174
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii russellii [TaxId:31159]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-110)
  Domains in SCOPe 2.06: d1sxka_
• Heterogens: SO4, BHA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxkA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c