PDB entry 1sxh

View 1sxh on RCSB PDB site
Description: apo structure of B. megaterium transcription regulator
Deposited on 2004-03-30, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.241
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sxha_
  • Chain 'D':
    Domains in SCOP 1.71: d1sxhd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxhA (A:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxhA (A:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sxhD (D:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxhD (D:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk