PDB entry 1sxh

View 1sxh on RCSB PDB site
Description: apo structure of B. megaterium transcription regulator
Class: transcription
Keywords: allosterism; phosphoprotein; transcription regulation; GRam positive bacteria; CCR
Deposited on 2004-03-30, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.241
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (Start-279)
      • modified residue (35)
      • modified residue (59)
      • modified residue (70)
      • modified residue (197)
      • modified residue (229)
      • modified residue (241)
      • modified residue (249)
      • modified residue (256)
    Domains in SCOPe 2.07: d1sxha_
  • Chain 'D':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus megaterium [TaxId:1404]
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (Start-279)
      • modified residue (35)
      • modified residue (59)
      • modified residue (70)
      • modified residue (197)
      • modified residue (229)
      • modified residue (241)
      • modified residue (249)
      • modified residue (256)
    Domains in SCOPe 2.07: d1sxhd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxhA (A:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxhA (A:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sxhD (D:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxhD (D:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk