PDB entry 1sxg

View 1sxg on RCSB PDB site
Description: Structural studies on the apo transcription factor form B. megaterium
Deposited on 2004-03-30, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sxga_
  • Chain 'B':
    Domains in SCOP 1.71: d1sxgb_
  • Chain 'D':
    Domains in SCOP 1.71: d1sxgd_
  • Chain 'F':
    Domains in SCOP 1.71: d1sxgf_
  • Chain 'I':
    Domains in SCOP 1.71: d1sxgi_
  • Chain 'P':
    Domains in SCOP 1.71: d1sxgp_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxgA (A:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxgA (A:)
    kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
    dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
    kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
    ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
    gavamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sxgB (B:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxgB (B:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sxgD (D:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxgD (D:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sxgF (F:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxgF (F:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sxgI (I:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxgI (I:)
    kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
    dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
    kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
    ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
    gavamrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1sxgP (P:)
    rglaskktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnm
    lgkqvdgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqsl
    idsghkniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieavek
    lleedekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvq
    pmydigavamrlltkymnketvdssivqlphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxgP (P:)
    tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
    iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
    iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
    ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
    vamrlltkymnketvdssivqlphriefrqstk