PDB entry 1sxe

View 1sxe on RCSB PDB site
Description: The solution structure of the Pointed (PNT) domain from the transcrition factor Erg
Class: transcription, signaling protein
Keywords: alpha helical
Deposited on 2004-03-30, released 2004-09-21
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-21, with a file datestamp of 2007-06-04.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcriptional regulator ERG
  Species: HOMO SAPIENS
  Gene: ERG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11308 (3-96)
    • cloning artifact (0-2)
  Domains in SCOP 1.73: d1sxea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxeA (A:)
  gshmeekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnid
  gkelckmtkddfqrltpsynadillshlhylretplp