PDB entry 1sxe

View 1sxe on RCSB PDB site
Description: the solution structure of the pointed (pnt) domain from the transcrition factor erg
Deposited on 2004-03-30, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1sxea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxeA (A:)
  gshmeekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnid
  gkelckmtkddfqrltpsynadillshlhylretplp