PDB entry 1sxd

View 1sxd on RCSB PDB site
Description: Solution Structure of the Pointed (PNT) Domain from mGABPa
Class: transcription, signaling protein
Keywords: alpha helical, TRANSCRIPTION, SIGNALING PROTEIN
Deposited on 2004-03-30, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GA repeat binding protein, alpha
    Species: Mus musculus [TaxId:10090]
    Gene: GABPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00422 (4-90)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1sxda1, d1sxda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxdA (A:)
    gshmaalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelc
    slnqedffqrvprgeilwshlellrkyvlas