PDB entry 1sx7

View 1sx7 on RCSB PDB site
Description: Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods
Class: hydrolase
Keywords: ab initio direct methods, HYDROLASE
Deposited on 2004-03-30, released 2004-11-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.12
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (71)
      • engineered (95)
    Domains in SCOPe 2.03: d1sx7a_
  • Heterogens: RB, CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sx7A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl