PDB entry 1sx6

View 1sx6 on RCSB PDB site
Description: Crystal structure of human Glycolipid Transfer protein in lactosylceramide-bound form
Class: lipid transport
Keywords: glycosphingolipid transfer protein-lactosylceramide complex, LIPID TRANSPORT
Deposited on 2004-03-30, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sx6a_
  • Heterogens: LAT, SPH, OLA, OCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sx6A (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sx6A (A:)
    laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
    pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
    irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskqnvteeeclekirlfl
    vnytatidviyemytqmnaelnykv