PDB entry 1sx2

View 1sx2 on RCSB PDB site
Description: Use of a Halide Binding Site to Bypass the 1000-atom Limit to Structure Determination by Direct Methods
Class: hydrolase
Keywords: Rb+ binding sites; Ab initio direct methods, HYDROLASE
Deposited on 2004-03-30, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (71)
      • engineered (95)
    Domains in SCOPe 2.08: d1sx2a_
  • Heterogens: RB, CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sx2A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl