PDB entry 1swy

View 1swy on RCSB PDB site
Description: Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure Determination
Class: hydrolase
Keywords: Rb+ binding sites, Ab initio direct methods, HYDROLASE
Deposited on 2004-03-30, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (71)
      • engineered (95)
    Domains in SCOPe 2.07: d1swya_
  • Heterogens: RB, CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1swyA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl