PDB entry 1swx

View 1swx on RCSB PDB site
Description: Crystal structure of a human glycolipid transfer protein in apo-form
Class: lipid transport
Keywords: glycosphingolipid intermembrane transfer protein, LIPID TRANSPORT
Deposited on 2004-03-30, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.175
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1swxa_
  • Heterogens: HEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1swxA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swxA (A:)
    llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
    rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
    atkayemalkkyhgwivqkifqaalyaapyksdflkalskteeeclekirlflvnytati
    dviyemytqmnaelnykv