PDB entry 1sww

View 1sww on RCSB PDB site
Description: Crystal structure of the phosphonoacetaldehyde hydrolase D12A mutant complexed with magnesium and substrate phosphonoacetaldehyde
Class: hydrolase
Keywords: phopshonoacetaldehyde hydrolase, phosphonatase, HAD enzym superfamily, metal binding
Deposited on 2004-03-30, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphonoacetaldehyde hydrolase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31156
      • engineered (11)
    Domains in SCOPe 2.07: d1swwa_
  • Chain 'B':
    Compound: phosphonoacetaldehyde hydrolase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31156
      • engineered (11)
    Domains in SCOPe 2.07: d1swwb_
  • Heterogens: MG, POA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1swwA (A:)
    mdrmkieavifawagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvral
    tempriasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergi
    kigsttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnh
    mikvgdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfven
    gahftietmqelesvmehiekqeliis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swwA (A:)
    kieavifawagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
    riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
    ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
    gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
    tietmqelesvmehiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1swwB (B:)
    mdrmkieavifawagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvral
    tempriasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergi
    kigsttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnh
    mikvgdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfven
    gahftietmqelesvmehiekqeliis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swwB (B:)
    kieavifawagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
    riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
    ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
    gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
    tietmqelesvmehiek