PDB entry 1swd

View 1swd on RCSB PDB site
Description: apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5
Class: biotin-binding protein
Keywords: biotin binding protein, signal, biotin, biotin-binding protein
Deposited on 1997-03-04, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1swda_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1swdb_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1swdc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1swdd_
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1swdA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swdA (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1swdB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swdB (B:)
    gitgtwynqlgstfivtagadgaltgtyenaesryvltgrydsapatdgsgtalgwtvaw
    knnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1swdC (C:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swdC (C:)
    gitgtwynqlgstfivtagadgaltgtyesnaesryvltgrydsapatdgsgtalgwtva
    wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1swdD (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1swdD (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv