PDB entry 1sw8

View 1sw8 on RCSB PDB site
Description: solution structure of the n-terminal domain of human n60d calmodulin refined with paramagnetism based strategy
Deposited on 2004-03-30, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sw8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sw8A (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgd
    gtidfpefltmmarkmkdt