PDB entry 1sw7

View 1sw7 on RCSB PDB site
Description: triosephosphate isomerase from gallus gallus, loop 6 mutant k174n, t175s, a176s
Deposited on 2004-03-30, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sw7a_
  • Chain 'B':
    Domains in SCOP 1.69: d1sw7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sw7A (A:)
    maprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakig
    vaaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnsstpqq
    aqevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpef
    vdiinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sw7A (A:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnsstpqqaqe
    vheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sw7B (B:)
    maprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakig
    vaaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnsstpqq
    aqevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpef
    vdiinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sw7B (B:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnsstpqqaqe
    vheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh