PDB entry 1sw3

View 1sw3 on RCSB PDB site
Description:
Deposited on 2004-03-30, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.145
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1sw3a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1sw3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sw3A (A:)
    maprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakig
    vaaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgkvatpqq
    aqevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpef
    vdiinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sw3A (A:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgkvatpqqa
    qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sw3B (B:)
    maprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakig
    vaaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgkvatpqq
    aqevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpef
    vdiinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sw3B (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgkvatpqqa
    qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh