PDB entry 1sw1

View 1sw1 on RCSB PDB site
Description: Crystal structure of ProX from Archeoglobus fulgidus in complex with proline betaine
Class: protein binding
Keywords: binding-protein, compatible solutes, cation-pi interactions, non-classical hydrogen bonds, PROTEIN BINDING
Deposited on 2004-03-30, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: osmoprotection protein (proX)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: proX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29280 (Start-274)
      • modified residue (23)
      • modified residue (169)
      • modified residue (174)
      • modified residue (245)
      • modified residue (264)
    Domains in SCOPe 2.08: d1sw1a_
  • Chain 'B':
    Compound: osmoprotection protein (proX)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: proX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29280 (Start-274)
      • modified residue (23)
      • modified residue (169)
      • modified residue (174)
      • modified residue (245)
      • modified residue (264)
    Domains in SCOPe 2.08: d1sw1b_
  • Heterogens: ZN, PBE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sw1A (A:)
    gsqsservvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqly
    veytgtaynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwa
    eengvekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaik
    nkqvdvipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledr
    idtdtmralnyqydvekkdareiamsflkeqglvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sw1A (A:)
    ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
    taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
    ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
    vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
    mralnyqydvekkdareiamsflkeqglvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sw1B (B:)
    gsqsservvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqly
    veytgtaynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwa
    eengvekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaik
    nkqvdvipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledr
    idtdtmralnyqydvekkdareiamsflkeqglvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sw1B (B:)
    ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
    taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
    ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
    vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
    mralnyqydvekkdareiamsflkeqglvk