PDB entry 1svz

View 1svz on RCSB PDB site
Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-2 protease
Class: immune system
Keywords: antibody-antigen complex; HIV inhibiting antibody, IMMUNE SYSTEM
Deposited on 2004-03-30, released 2005-03-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-chain Fv fragment 1696
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1svza1, d1svza2
  • Chain 'B':
    Compound: single-chain Fv fragment 1696
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1svzb1, d1svzb2
  • Chain 'C':
    Compound: epitope peptide corresponding to N-terminus of HIV-2 protease
    Database cross-references and differences (RAF-indexed):
    • PDB 1SVZ (0-End)
  • Chain 'D':
    Compound: epitope peptide corresponding to N-terminus of HIV-2 protease
    Database cross-references and differences (RAF-indexed):
    • PDB 1SVZ (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svzA (A:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikggggsggg
    gsggggsevqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwint
    etdeptfaddfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqg
    ttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svzA (A:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikevqlqqsg
    pelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptfaddfkgrf
    afsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1svzB (B:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikggggsggg
    gsggggsevqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwint
    etdeptfaddfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqg
    ttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svzB (B:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikevqlqqsg
    pelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptfaddfkgrf
    afsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.