PDB entry 1svy

View 1svy on RCSB PDB site
Description: severin domain 2, 1.75 angstrom crystal structure
Class: actin-binding protein
Keywords: actin-binding protein, calcium-binding, cytoskeleton, gelsolin, severin, villin, calcium, pip2
Deposited on 1998-08-10, released 1999-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: severin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10733
      • conflict (86)
    Domains in SCOPe 2.03: d1svya_
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1svyA (A:)
sgfnhvkpteykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngskssp
qeknkaaevaraidaerkglpkvevfcetdsdipaefwkllggkgaiaakheta

    Sequence, based on observed residues (ATOM records): (download) 
    >1svyA (A:)
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllggkgaiaakh