PDB entry 1svv

View 1svv on RCSB PDB site
Description: initial stuctural analysis of leishmania major threonine aldolase
Deposited on 2004-03-30, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1svva_
  • Chain 'B':
    Domains in SCOP 1.69: d1svvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svvA (A:)
    mstprttataakpkpysfvndysvgmhpkildlmardnmtqhagygqdshcakaarlige
    llerpdadvhfisggtqtnliacslalrpweaviatqlghisthetgaieatghkvvtap
    cpdgklrvadiesalhenrsehmvipklvyisnttevgtqytkqeledisasckehglyl
    fldgarlasalsspvndltladiarltdmfyigatkaggmfgealiilndalkpnarhli
    kqrgalmakgwllgiqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnql
    fpilentmiaelnndfdmytveplkdgtcimrlctswateekechrfvevlkrlvasta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svvA (A:)
    pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
    gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
    lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
    vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
    iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
    dfdmytveplkdgtcimrlctswateekechrfvevlkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1svvB (B:)
    mstprttataakpkpysfvndysvgmhpkildlmardnmtqhagygqdshcakaarlige
    llerpdadvhfisggtqtnliacslalrpweaviatqlghisthetgaieatghkvvtap
    cpdgklrvadiesalhenrsehmvipklvyisnttevgtqytkqeledisasckehglyl
    fldgarlasalsspvndltladiarltdmfyigatkaggmfgealiilndalkpnarhli
    kqrgalmakgwllgiqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnql
    fpilentmiaelnndfdmytveplkdgtcimrlctswateekechrfvevlkrlvasta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svvB (B:)
    pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
    gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
    lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
    vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
    iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
    dfdmytveplkdgtcimrlctswateekechrfvevlkrlva