PDB entry 1svv

View 1svv on RCSB PDB site
Description: Initial Stuctural Analysis of Leishmania major Threonine Aldolase
Class: lyase
Keywords: structural genomics, Structural Genomics of Pathogenic Protozoa, SGPP, Protein Structure Initiative, PSI, Structural Genomics of Pathogenic Protozoa Consortium, LYASE
Deposited on 2004-03-30, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine aldolase
    Species: Leishmania major [TaxId:5664]
    Gene: L4171.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15839
      • modified residue (25)
      • modified residue (33)
      • modified residue (38)
      • modified residue (142)
      • modified residue (208)
      • modified residue (219)
      • modified residue (246)
      • modified residue (260)
      • modified residue (275)
      • modified residue (307)
      • modified residue (317)
      • modified residue (330)
    Domains in SCOPe 2.07: d1svva_
  • Chain 'B':
    Compound: threonine aldolase
    Species: Leishmania major [TaxId:5664]
    Gene: L4171.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15839
      • modified residue (25)
      • modified residue (33)
      • modified residue (38)
      • modified residue (142)
      • modified residue (208)
      • modified residue (219)
      • modified residue (246)
      • modified residue (260)
      • modified residue (275)
      • modified residue (307)
      • modified residue (317)
      • modified residue (330)
    Domains in SCOPe 2.07: d1svvb_
  • Heterogens: UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svvA (A:)
    mstprttataakpkpysfvndysvgmhpkildlmardnmtqhagygqdshcakaarlige
    llerpdadvhfisggtqtnliacslalrpweaviatqlghisthetgaieatghkvvtap
    cpdgklrvadiesalhenrsehmvipklvyisnttevgtqytkqeledisasckehglyl
    fldgarlasalsspvndltladiarltdmfyigatkaggmfgealiilndalkpnarhli
    kqrgalmakgwllgiqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnql
    fpilentmiaelnndfdmytveplkdgtcimrlctswateekechrfvevlkrlvasta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svvA (A:)
    pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
    gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
    lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
    vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
    iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
    dfdmytveplkdgtcimrlctswateekechrfvevlkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1svvB (B:)
    mstprttataakpkpysfvndysvgmhpkildlmardnmtqhagygqdshcakaarlige
    llerpdadvhfisggtqtnliacslalrpweaviatqlghisthetgaieatghkvvtap
    cpdgklrvadiesalhenrsehmvipklvyisnttevgtqytkqeledisasckehglyl
    fldgarlasalsspvndltladiarltdmfyigatkaggmfgealiilndalkpnarhli
    kqrgalmakgwllgiqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnql
    fpilentmiaelnndfdmytveplkdgtcimrlctswateekechrfvevlkrlvasta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svvB (B:)
    pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
    gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
    lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
    vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
    iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
    dfdmytveplkdgtcimrlctswateekechrfvevlkrlva