PDB entry 1svu

View 1svu on RCSB PDB site
Description: Structure of the Q237W mutant of HhaI DNA methyltransferase: an insight into protein-protein interactions
Class: transferase
Keywords: DNA methyltransferase, protein-protein interactions, evolutionary link, Type I and II restriction-modification systems
Deposited on 2004-03-30, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.189
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • engineered (236)
    Domains in SCOPe 2.06: d1svua_
  • Chain 'B':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05102 (0-326)
      • engineered (236)
    Domains in SCOPe 2.06: d1svub_
  • Heterogens: SO4, SAH, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svuA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggwger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svuA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagflffdiarivrekkpkvvfmenvknfashdngntlevvkntm
    neldysfhakvlnaldygipqkreriymicfrndlniqnfqfpkpfelntfvkdlllpds
    evehlvidrkdlvmtnqeieqttpktvrlgivgkggwgeriystrgiaitlsaygggifa
    ktggylvngktrklhprecarvmgypdsykvhpstsqaykqfgnsvvinvlqyiaynigs
    slnfkpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1svuB (B:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggwger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svuB (B:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqargtlffdiarivrekkpkvvfmenvknfashdngntl
    evvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnfqfpkpfelntfvk
    dlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggwgeriystrgiaitlsa
    ygggifaktggylvngktrklhprecarvmgypdsykvhpstsqaykqfgnsvvinvlqy
    iaynigsslnfkpy