PDB entry 1svq

View 1svq on RCSB PDB site
Description: structure of severin domain 2 in solution
Deposited on 1994-10-12, released 1995-02-07
The last revision prior to the SCOP 1.69 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1svq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1svq_ (-)
    sgfnhvkpteykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngskssp
    qeknkaaevaraidaerkglpkvevfcetdsdipaefwkllggkgaiaakheta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svq_ (-)
    eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
    araidaerkglpkvevfcetdsdipaefwkllgg