PDB entry 1svo

View 1svo on RCSB PDB site
Description: Structure of SV40 large T antigen helicase domain
Deposited on 2004-03-29, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1svoa_
  • Chain 'B':
    Domains in SCOP 1.71: d1svob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svoA (A:)
    glkehdfnpeeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeq
    pshykyhekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlld
    rmdimfgstgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpids
    gkttlaaallelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqg
    innldnlrdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpk
    dylkhclersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefsls
    vyqkmkfnvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svoA (A:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1svoB (B:)
    glkehdfnpeeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeq
    pshykyhekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlld
    rmdimfgstgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpids
    gkttlaaallelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqg
    innldnlrdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpk
    dylkhclersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefsls
    vyqkmkfnvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svoB (B:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld