PDB entry 1svk

View 1svk on RCSB PDB site
Description: Structure of the K180P mutant of Gi alpha subunit bound to AlF4 and GDP
Class: hydrolase, signaling protein
Keywords: Gi alpha subunit, K180P mutation, Active form, HYDROLASE, SIGNALING PROTEIN
Deposited on 2004-03-29, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GNAI1, GNAI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10824
      • engineered (178)
    Domains in SCOPe 2.08: d1svka1
  • Heterogens: MG, ALF, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svkA (A:)
    gctlsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagy
    seeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmta
    elagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvpt
    tgivethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemn
    rmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaa
    yiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svkA (A:)
    evkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlk
    idfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsa
    ayylndldriaqpnyiptqqdvlrtrvpttgivethftfkdlhfkmfdvggqrserkkwi
    hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
    lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
    qfvfdavtdviik