PDB entry 1sv9

View 1sv9 on RCSB PDB site
Description: Crystal structure of the complex formed between groupII phospholipase A2 and anti-inflammatory agent 2-[(2,6-Dichlorophenyl)amino] benzeneacetic acid at 2.7A resolution
Class: toxin
Keywords: Phospholipase A2,complex,diclofenac,crystal structure,2.7A resolution, TOXIN
Deposited on 2004-03-29, released 2004-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russellii russellii [TaxId:31159]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-110)
  Domains in SCOPe 2.06: d1sv9a_
• Heterogens: DIF, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sv9A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c