PDB entry 1sv8

View 1sv8 on RCSB PDB site
Description: Crystal structure of a signaling protein from buffalo(SPB-40)at 2.8 A resolution using crystals grown in the prsence of carbohydrates
Deposited on 2004-03-28, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv8A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
    pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
    v