PDB entry 1sv7

View 1sv7 on RCSB PDB site
Description: Hypothetical Protein At2g24940.1 from Arabidopsis thaliana Adopts a Cytochrome b5 like Fold
Class: structural genomics, unknown function
Keywords: cytochrome b5 like fold
Deposited on 2004-03-28, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2004-04-13, with a file datestamp of 2007-04-25.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5 domain-containing protein
    Species: Arabidopsis thaliana
    Gene: At2g24940.1
    Database cross-references and differences (RAF-indexed):
    • GB NP_180066 (9-108)
      • cloning artifact (1)
      • his tag (2-7)
      • cloning artifact (8-9)
    Domains in SCOPe 2.08: d1sv7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv7A (A:)
    mghhhhhhleeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkd
    asralgkmskneedvspslegltekeintlndwetkfeakypvvgrvvs