PDB entry 1sv4

View 1sv4 on RCSB PDB site
Description: Crystal Structure of Yan-SAM
Deposited on 2004-03-27, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sv4a_
  • Chain 'B':
    Domains in SCOP 1.69: d1sv4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sv4A (A:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv4A (A:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sv4B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv4B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsr