PDB entry 1sv4

View 1sv4 on RCSB PDB site
Description: Crystal Structure of Yan-SAM
Class: transcription
Keywords: alpha-helix, 3(10)-helix, TRANSCRIPTION
Deposited on 2004-03-27, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ets DNA-binding protein pokkuri
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: AOP, POK, YAN, CG3166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01842 (0-76)
      • engineered (44)
      • cloning artifact (77)
    Domains in SCOPe 2.07: d1sv4a1, d1sv4a2
  • Chain 'B':
    Compound: Ets DNA-binding protein pokkuri
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: AOP, POK, YAN, CG3166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01842 (0-76)
      • engineered (44)
      • cloning artifact (77-78)
    Domains in SCOPe 2.07: d1sv4b1, d1sv4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sv4A (A:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv4A (A:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sv4B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv4B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsr