PDB entry 1sv3

View 1sv3 on RCSB PDB site
Description: Structure of the complex formed between Phospholipase A2 and 4-methoxybenzoic acid at 1.3A resolution.
Class: hydrolase
Keywords: Phospholipase A2, complex, 4-methoxybenzoic acid, crystal structure, 1.3A resolution, hydrolase
Deposited on 2004-03-27, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.21
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sv3a_
  • Heterogens: SO4, ANN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv3A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c