PDB entry 1sv3

View 1sv3 on RCSB PDB site
Description: Structure of the complex formed between Phospholipase A2 and 4-methoxybenzoic acid at 1.3A resolution.
Class: hydrolase
Keywords: Phospholipase A2, complex, 4-methoxybenzoic acid, crystal structure, 1.3A resolution
Deposited on 2004-03-27, released 2004-04-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.21
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russelli pulchella
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-49)
  Domains in SCOP 1.73: d1sv3a_
• Heterogens: SO4, ANN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sv3A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c