PDB entry 1sv1

View 1sv1 on RCSB PDB site
Description: NMR structure of the ThKaiA180C-CIIABD complex (25-structure ensemble)
Deposited on 2004-03-26, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sv1a_
  • Chain 'B':
    Domains in SCOP 1.69: d1sv1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv1A (A:)
    amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
    velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv1B (B:)
    amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
    velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev