PDB entry 1sv0

View 1sv0 on RCSB PDB site
Description: crystal structure of yan-sam/mae-sam complex
Deposited on 2004-03-26, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.232
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sv0a_
  • Chain 'B':
    Domains in SCOP 1.69: d1sv0b_
  • Chain 'C':
    Domains in SCOP 1.69: d1sv0c_
  • Chain 'D':
    Domains in SCOP 1.69: d1sv0d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sv0A (A:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv0A (A:)
    lppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpga
    gdvlhnvlqmliieshs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sv0B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv0B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv0C (C:)
    plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
    vpvggkmlyrdfrvrlaramsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sv0D (D:)
    plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
    vpvggkmlyrdfrvrlaramsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv0D (D:)
    lgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcrv
    pvggkmlyrdfrvrlaramsr