PDB entry 1sv0

View 1sv0 on RCSB PDB site
Description: Crystal Structure Of Yan-SAM/Mae-SAM Complex
Class: transcription
Keywords: alpha-helix, 3(10) helix, TRANSCRIPTION
Deposited on 2004-03-26, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.232
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ets DNA-binding protein pokkuri
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: AOP, POK, YAN, CG3166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01842 (Start-76)
      • engineered (44)
      • cloning artifact (77)
    Domains in SCOPe 2.07: d1sv0a1, d1sv0a2
  • Chain 'B':
    Compound: Ets DNA-binding protein pokkuri
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: AOP, POK, YAN, CG3166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01842 (0-76)
      • engineered (44)
      • cloning artifact (77-78)
    Domains in SCOPe 2.07: d1sv0b1, d1sv0b2
  • Chain 'C':
    Compound: modulator of the activity of Ets CG15085-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Mae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I7G2 (0-81)
      • cloning artifact (80-81)
    Domains in SCOPe 2.07: d1sv0c1, d1sv0c2
  • Chain 'D':
    Compound: modulator of the activity of Ets CG15085-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Mae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I7G2 (Start-81)
      • cloning artifact (80-81)
    Domains in SCOPe 2.07: d1sv0d1, d1sv0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sv0A (A:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv0A (A:)
    lppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpga
    gdvlhnvlqmliieshs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sv0B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv0B (B:)
    qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
    agdvlhnvlqmliieshsr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv0C (C:)
    plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
    vpvggkmlyrdfrvrlaramsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sv0D (D:)
    plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
    vpvggkmlyrdfrvrlaramsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sv0D (D:)
    lgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcrv
    pvggkmlyrdfrvrlaramsr