PDB entry 1sux

View 1sux on RCSB PDB site
Description: crystallographic analysis of the complex between triosephosphate isomerase from trypanosoma cruzi and 3-(2-benzothiazolylthio)-1- propanesulfonic acid
Deposited on 2004-03-26, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1suxa_
  • Chain 'B':
    Domains in SCOP 1.69: d1suxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1suxA (A:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1suxA (A:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1suxB (B:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1suxB (B:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk