PDB entry 1sux

View 1sux on RCSB PDB site
Description: CRYSTALLOGRAPHIC ANALYSIS OF THE COMPLEX BETWEEN TRIOSEPHOSPHATE ISOMERASE FROM TRYPANOSOMA CRUZI AND 3-(2-benzothiazolylthio)-1-propanesulfonic acid
Class: isomerase
Keywords: triosephosphate isomerase, trypanosoma cruzi, protein interfaces, benzothiazole inhibitor, isomerase
Deposited on 2004-03-26, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1suxa_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1suxb_
  • Heterogens: SO4, BTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1suxA (A:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1suxA (A:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1suxB (B:)
    maskpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpk
    fqiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaa
    gfhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvat
    pqqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslk
    pefveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1suxB (B:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk