PDB entry 1suv

View 1suv on RCSB PDB site
Description: Structure of Human Transferrin Receptor-Transferrin Complex
Deposited on 2004-03-26, released 2004-04-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: EM
Resolution: 7.5 Å
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1suva_
  • Chain 'B':
    Domains in SCOP 1.69: d1suvb_
  • Chain 'C':
    Domains in SCOP 1.69: d1suvc_
  • Chain 'D':
    Domains in SCOP 1.69: d1suvd_
  • Chain 'E':
    Domains in SCOP 1.69: d1suve_
  • Chain 'F':
    Domains in SCOP 1.69: d1suvf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suvA (A:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suvB (B:)
    lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
    wrdqhfvkiqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkk
    dfedlytpvngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffgha
    hlgtgdpytpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktds
    tcrmvtsesknvkltvsnvlkeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgv
    gtalllklaqmfsdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkafty
    inldkavlgtsnfkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaa
    fpflaysgipavsfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfvikl
    thdvelnldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfg
    naektdrfvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkq
    nngafnetlfrnqlalatwtiqgaanalsgdvwdidnef
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suvC (C:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suvD (D:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suvE (E:)
    pdplqdeckavkwcalghherlkcdewsvtsggliecesaetpedciakimngeadamsl
    dggyvyiagqcglvpvlaenyestdckkapeegylsvavvkksnpdinwnnlegkkscht
    avdrtagwnipmgllynrinhcrfdeffrqgcapgsqknsslcelcvgpsvcapnnregy
    ygytgafrclvekgdvafvksqtvlqntggrnsepwakdlkeedfellcldgtrkpvsea
    hnchlakapnhavvsrkdkaacvkqklldlqvefgntvadcsskfcmfhsktkdllfrdd
    tkclvdlrgkntyekylgadyikavsnlrkcstsrlleactfhkh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suvF (F:)
    pdplqdeckavkwcalghherlkcdewsvtsggliecesaetpedciakimngeadamsl
    dggyvyiagqcglvpvlaenyestdckkapeegylsvavvkksnpdinwnnlegkkscht
    avdrtagwnipmgllynrinhcrfdeffrqgcapgsqknsslcelcvgpsvcapnnregy
    ygytgafrclvekgdvafvksqtvlqntggrnsepwakdlkeedfellcldgtrkpvsea
    hnchlakapnhavvsrkdkaacvkqklldlqvefgntvadcsskfcmfhsktkdllfrdd
    tkclvdlrgkntyekylgadyikavsnlrkcstsrlleactfhkh