PDB entry 1suu

View 1suu on RCSB PDB site
Description: Structure of DNA gyrase A C-terminal domain
Deposited on 2004-03-26, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1suua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1suuA (A:)
    msdlmqkenivvmltkkgflkrlsqneyklqgtggkglssfdlndgdeivialcvnthdy
    lfmisnegklylinayeikdssraskgqniselinlgdqeeiltiknskdltddaylllt
    tasgkiarfestdfkavksrgviviklndkdfvtsaeivfkdekviclskkgsafifnsr
    dvrltnrgtqgvcgmklkegdlfvkvlsvkenpyllivsengygkrlnmskiselkrgat
    gytsykksdkkagsvvdaiavseddeillvskrskalrtvagkvseqgkdargiqvlfld
    ndslvsvskfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1suuA (A:)
    enivvmltkkgflkrlsqneyklqgtggkglssfdlndgdeivialcvnthdylfmisne
    gklylinayeikdqniselinlgdqeeiltiknskdltddaylllttasgkiarfestdf
    kagviviklndkdfvtsaeivfkdekviclskkgsafifnsrdvrltnrgtqgvcgmklk
    egdlfvkvlsvkenpyllivsengygkrlnmskiselkrgatgytsykksdkkagsvvda
    iavseddeillvskrskalrtvagkvseqgkdargiqvlfldndslvsvskfi