PDB entry 1sus

View 1sus on RCSB PDB site
Description: Crystal structure of alfalfa feruoyl coenzyme A 3-O-methyltransferase
Class: transferase
Keywords: rossmann fold, protein-cofactor-substrate complex, o-methyltransferase, transferase
Deposited on 2004-03-26, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeoyl-CoA O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Gene: CCOMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1susa_
  • Chain 'B':
    Compound: Caffeoyl-CoA O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Gene: CCOMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1susb_
  • Chain 'C':
    Compound: Caffeoyl-CoA O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Gene: CCOMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1susc_
  • Chain 'D':
    Compound: Caffeoyl-CoA O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Gene: CCOMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1susd_
  • Heterogens: CA, SAH, SPF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1susA (A:)
    matnedqkqtesgrhqevghksllqsdalyqyiletsvfpreheamkelrevtakhpwni
    mttsadegqflsmllklinakntmeigvytgysllatalaipedgkilamdinkenyelg
    lpvikkagvdhkidfregpalpvldemikdeknhgsydfifvdadkdnylnyhkrlidlv
    kvggvigydntlwngsvvappdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgi
    ticrrik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1susA (A:)
    ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
    kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
    lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
    pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1susB (B:)
    matnedqkqtesgrhqevghksllqsdalyqyiletsvfpreheamkelrevtakhpwni
    mttsadegqflsmllklinakntmeigvytgysllatalaipedgkilamdinkenyelg
    lpvikkagvdhkidfregpalpvldemikdeknhgsydfifvdadkdnylnyhkrlidlv
    kvggvigydntlwngsvvappdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgi
    ticrrik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1susB (B:)
    ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
    kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
    lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
    pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1susC (C:)
    matnedqkqtesgrhqevghksllqsdalyqyiletsvfpreheamkelrevtakhpwni
    mttsadegqflsmllklinakntmeigvytgysllatalaipedgkilamdinkenyelg
    lpvikkagvdhkidfregpalpvldemikdeknhgsydfifvdadkdnylnyhkrlidlv
    kvggvigydntlwngsvvappdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgi
    ticrrik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1susC (C:)
    ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
    kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
    lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
    pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1susD (D:)
    matnedqkqtesgrhqevghksllqsdalyqyiletsvfpreheamkelrevtakhpwni
    mttsadegqflsmllklinakntmeigvytgysllatalaipedgkilamdinkenyelg
    lpvikkagvdhkidfregpalpvldemikdeknhgsydfifvdadkdnylnyhkrlidlv
    kvggvigydntlwngsvvappdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgi
    ticrrik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1susD (D:)
    ksllqsdalyqyiletsvfpreheamkelrevtakhpwnimttsadegqflsmllklina
    kntmeigvytgysllatalaipedgkilamdinkenyelglpvikkagvdhkidfregpa
    lpvldemikdeknhgsydfifvdadkdnylnyhkrlidlvkvggvigydntlwngsvvap
    pdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik