PDB entry 1suo

View 1suo on RCSB PDB site
Description: Structure of mammalian cytochrome P450 2B4 with bound 4-(4-chlorophenyl)imidazole
Class: oxidoreductase
Keywords: oxidoreductase, membrane protein, CYP 2B4, CYP LM2, Cytochrome p450, Monooxygenase
Deposited on 2004-03-26, released 2004-07-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B4
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CYP2B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00178 (Start-471)
      • engineered (9)
      • see remark 999 (201)
      • engineered (206)
      • expression tag (472)
    Domains in SCOPe 2.05: d1suoa_
  • Heterogens: HEM, CPZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1suoA (A:)
    makktsskgklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlc
    gtdairealvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgk
    rsveeriqeearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrll
    dlffqsfslissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldps
    nprdfidvyllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyph
    vtervqkeieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrg
    yvipkntevfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclge
    giartelflffttilqnfsiaspvppedidltpresgvgnvppsyqirflarhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1suoA (A:)
    gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
    lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
    eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
    lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
    yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
    ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
    vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
    lffttilqnfsiaspvppedidltpresgvgnvppsyqirflarh