PDB entry 1sum

View 1sum on RCSB PDB site
Description: Crystal structure of a hypothetical protein at 2.0 A resolution
Class: transport protein
Keywords: PhoU, ABC transport, pst, Structural Genomics, Berkeley Structural Genomics Center, BSGC, structure funded by NIH, Protein Structure Initiative, PSI, TRANSPORT PROTEIN
Deposited on 2004-03-26, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Phosphate transport system protein phoU homolog 2
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sumb_
  • Heterogens: FE, NI, CA, PO3, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sumB (B:)
    mnrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiq
    ekamevlglfspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledip
    amanqtsemlkfalrmfadvnveksfevcrmdskvddlyekvreelllymmespkyvkra
    lllleiagnieiiadyatnivevsvymvqgeaykcyhdelllfkksggvlfessd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sumB (B:)
    nrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqe
    kamevlglfspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipa
    manqtsemlkfalrmfadvnveksfevcrmdskvddlyekvreelllymmespkyvkral
    llleiagnieiiadyatnivevsvymvqgeaykcyhdelllfkks